PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G102400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 207aa    MW: 22010.1 Da    PI: 6.7891
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G102400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB133.75.6e-42188895
               NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                        +Pianv+rim++vlP +akis+dake+vqec sefisf+t+ea+++c +e+rk ++++d+lwa+ +lGf+dy++p+++y ++ r++e+
  Brast07G102400.1.p  1 MPIANVTRIMRRVLPPHAKISDDAKELVQECTSEFISFLTGEANEQCLKERRKIVSAEDILWAMDNLGFDDYIQPITKYARRMRDIEN 88
                        8************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.3E-24164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471132.55E-31187IPR009072Histone-fold
Gene3DG3DSA:1.10.20.109.2E-39188IPR009072Histone-fold
PRINTSPR006152.2E-122846No hitNo description
PRINTSPR006152.2E-124765No hitNo description
PRINTSPR006152.2E-126684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MPIANVTRIM RRVLPPHAKI SDDAKELVQE CTSEFISFLT GEANEQCLKE RRKIVSAEDI  60
LWAMDNLGFD DYIQPITKYA RRMRDIENGV VVVNPLVVAG AAGPRAPAPR PPLVPAEAVA  120
SQALMQMQRG AMYAPRPPAP AQQVYFVAAM PLQVRAPAPL VGGQQGNVSG GQRHVAPYHG  180
GEKPADGEGS SRGTGDVGDE ASSSSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-31185993NF-YB
4csr_A4e-311851094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B4e-311851094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229872.12e-84PREDICTED: nuclear transcription factor Y subunit beta-like
SwissprotQ84W661e-43NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A0Q3K2Q13e-84A0A0Q3K2Q1_BRADI; Uncharacterized protein
TrEMBLI1GZ043e-84I1GZ04_BRADI; Uncharacterized protein
STRINGBRADI1G43460.19e-84(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2918324
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-43nuclear factor Y, subunit B6